PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5429_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 426aa    MW: 47365.1 Da    PI: 9.8061
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5429_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.93.9e-186723199
                .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
          B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                + s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l+++v+r+
  RrC5429_p1  6 RPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRLGVRRA 72
                45679999*********************************************..3489999****997 PP

2Auxin_resp113.42.2e-3798179182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +aha+st+++F+++YnP+as+s+F++++ k++k+++ ++++GmRfk ++e+ed+serr  G+++g+++ldp+rWp+SkWr+L
  RrC5429_p1  98 VAHAISTNTAFNIYYNPKASWSNFIIPAPKFLKTVDYPFCIGMRFKARVESEDASERRSPGIITGINELDPIRWPGSKWRCL 179
                 79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.774173IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-20177IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-22280IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0033273IPR003340B3 DNA binding domain
PfamPF023621.1E-15572IPR003340B3 DNA binding domain
CDDcd100177.85E-13571No hitNo description
PfamPF065072.8E-3198179IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
DYSQPRPSQE LLARDLHGLE WRFRHIYRGQ PRRHLLTTGW SAFVNKKKLV SGDAVLFLRG  60
DDGKLRLGVR RASQIEGASS AFSSQYNQNM NHNNFAEVAH AISTNTAFNI YYNPKASWSN  120
FIIPAPKFLK TVDYPFCIGM RFKARVESED ASERRSPGII TGINELDPIR WPGSKWRCLL  180
VRWDDIEANG HHQQRLSPWE IEPSGSISSS GSFITTGPKR SRIGSDIPVS QGIRSTDFEE  240
SLRFQMVLQG QEIFHGGFIN TSSDGGAGAR RGKFKGTEFG DSYGGFHKVL QGQETVPAYP  300
MMTDHHHRQH QGMMMMSQRN IWCGPFQNFS TRILPPSSVH VSSSSSSPSS GGPNARLEEQ  360
HHGGSGRCRL FGFPLRDETT AVVGPCVEGQ NGSSMRGGGG ASAVQSNHHG RRDIYGMRDM  420
LLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B7e-591210154361Auxin response factor 1
4ldy_A7e-591210154361Auxin response factor 1
4ldw_B7e-591210154361Auxin response factor 1
4ldw_A7e-591210154361Auxin response factor 1
4ldv_A7e-591210154361Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794620.0JN979462.1 Brassica rapa subsp. pekinensis auxin response factor 3-1 (ARF3-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631127.10.0PREDICTED: auxin response factor 3-like
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0D3BSB50.0A0A0D3BSB5_BRAOL; Auxin response factor
STRINGBra005465.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein