PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5429_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 426aa    MW: 47365.1 Da    PI: 9.8061
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5429_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.93.9e-186723199
                .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
          B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                + s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l+++v+r+
  RrC5429_p1  6 RPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRLGVRRA 72
                45679999*********************************************..3489999****997 PP

2Auxin_resp113.42.2e-3798179182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +aha+st+++F+++YnP+as+s+F++++ k++k+++ ++++GmRfk ++e+ed+serr  G+++g+++ldp+rWp+SkWr+L
  RrC5429_p1  98 VAHAISTNTAFNIYYNPKASWSNFIIPAPKFLKTVDYPFCIGMRFKARVESEDASERRSPGIITGINELDPIRWPGSKWRCL 179
                 79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.774173IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-20177IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-22280IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0033273IPR003340B3 DNA binding domain
PfamPF023621.1E-15572IPR003340B3 DNA binding domain
CDDcd100177.85E-13571No hitNo description
PfamPF065072.8E-3198179IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
DYSQPRPSQE LLARDLHGLE WRFRHIYRGQ PRRHLLTTGW SAFVNKKKLV SGDAVLFLRG  60
DDGKLRLGVR RASQIEGASS AFSSQYNQNM NHNNFAEVAH AISTNTAFNI YYNPKASWSN  120
FIIPAPKFLK